Lineage for d1j0ha3 (1j0h A:124-505)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 384382Superfamily c.1.8: (Trans)glycosidases [51445] (10 families) (S)
  5. 384383Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 384695Protein Neopullulanase, central domain [82240] (1 species)
    homologous to Maltogenic amylase
  7. 384696Species Bacillus stearothermophilus [TaxId:1422] [82241] (4 PDB entries)
  8. 384697Domain d1j0ha3: 1j0h A:124-505 [77029]
    Other proteins in same PDB: d1j0ha1, d1j0ha2, d1j0hb1, d1j0hb2

Details for d1j0ha3

PDB Entry: 1j0h (more details), 1.9 Å

PDB Description: Crystal structure of Bacillus stearothermophilus neopullulanase

SCOP Domain Sequences for d1j0ha3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus}
dlfeapdwvkdtvwyqifperfangnpsispegsrpwgsedptptsffggdlqgiidhld
ylvdlgitgiyltpifrspsnhkydtadyfevdphfgdketlktlidrchekgirvmlda
vfnhcgyefapfqdvwkngesskykdwfhihefplqteprpnydtfafvpqmpklntanp
evkrylldvatywirefdidgwrldvaneidhefwrefrqevkalkpdvyilgeiwhdam
pwlrgdqfdavmnypftdgvlrffakeeisarqfanqmmhvlhsypnnvneaafnllgsh
dtsriltvcggdirkvkllflfqltftgspciyygdeigmtggndpecrkcmvwdpmqqn
kelhqhvkqlialrkqyrslrr

SCOP Domain Coordinates for d1j0ha3:

Click to download the PDB-style file with coordinates for d1j0ha3.
(The format of our PDB-style files is described here.)

Timeline for d1j0ha3: