Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (10 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein Neopullulanase, central domain [82240] (1 species) homologous to Maltogenic amylase |
Species Bacillus stearothermophilus [TaxId:1422] [82241] (4 PDB entries) |
Domain d1j0ha3: 1j0h A:124-505 [77029] Other proteins in same PDB: d1j0ha1, d1j0ha2, d1j0hb1, d1j0hb2 |
PDB Entry: 1j0h (more details), 1.9 Å
SCOP Domain Sequences for d1j0ha3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus} dlfeapdwvkdtvwyqifperfangnpsispegsrpwgsedptptsffggdlqgiidhld ylvdlgitgiyltpifrspsnhkydtadyfevdphfgdketlktlidrchekgirvmlda vfnhcgyefapfqdvwkngesskykdwfhihefplqteprpnydtfafvpqmpklntanp evkrylldvatywirefdidgwrldvaneidhefwrefrqevkalkpdvyilgeiwhdam pwlrgdqfdavmnypftdgvlrffakeeisarqfanqmmhvlhsypnnvneaafnllgsh dtsriltvcggdirkvkllflfqltftgspciyygdeigmtggndpecrkcmvwdpmqqn kelhqhvkqlialrkqyrslrr
Timeline for d1j0ha3: